PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Peinf101Scf00280g02001.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Petunioideae; Petunia; Petunia integrifolia
Family M-type_MADS
Protein Properties Length: 203aa    MW: 23282.6 Da    PI: 5.3282
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Peinf101Scf00280g02001.1genomeSGNView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF44.81.6e-1414461446
                              HHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEE CS
                    SRF-TF 14 skRrngilKKAeELSvLCdaevaviifsstgkl 46
                               +  + ++KKA+ELSvLC+++va+iifs++ k+
  Peinf101Scf00280g02001.1 14 PRKVTSLFKKAQELSVLCNVQVAIIIFSPDEKV 46
                              444467************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004321.4E-4152IPR002100Transcription factor, MADS-box
PROSITE profilePS5006612.222446IPR002100Transcription factor, MADS-box
PfamPF003192.1E-12746IPR002100Transcription factor, MADS-box
SuperFamilySSF554552.35E-14885IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 203 aa     Download sequence    Send to blast
MASNSASERN ALLPRKVTSL FKKAQELSVL CNVQVAIIIF SPDEKVPIMW PSETQVRQRL  60
TSYLGQSEFQ RSKKLVLHEK YLLEKLECKA EEIRKMEEKR EMEFLFNELV KGMSIYELDA  120
KELRGLIKLA TLKLAKVEER KKQLNEERKK LEEERKKKLN EDDVQPAEPP VAGGESGAGP  180
DLEEGDNKNA GEEKDDEHPK DSN
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1139157RKKQLNEERKKLEEERKKK
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankFJ1685131e-136FJ168513.1 Petunia x hybrida type I MADS box transcription factor (MADSy8) gene, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015060998.14e-43PREDICTED: agamous-like MADS-box protein AGL90
RefseqXP_015061001.15e-43PREDICTED: agamous-like MADS-box protein AGL90
TrEMBLB6DT651e-103B6DT65_PETHY; Type I MADS box transcription factor (Fragment)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA37820129
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G27960.14e-14AGAMOUS-like 90